PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005683
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 319aa    MW: 35486.6 Da    PI: 9.8277
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005683genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.6e-1660105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed++l+++v+++G+ +W+ Ia+ +  gR++k+c++rw++ 
      Lus10005683  60 RGHWRPSEDDKLKELVTRFGPQNWNEIAENLA-GRSGKSCRLRWFNQ 105
                      899*****************************.***********996 PP

2Myb_DNA-binding53.46e-17115156447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +++eE+++l+ a++++G++ W+ Ia++++ gRt++ +k++w+  
      Lus10005683 115 FSEEEEDRLITAHRMYGNK-WAMIAKMFP-GRTDNAVKNHWHVM 156
                      8******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.04455106IPR017930Myb domain
SMARTSM007171.4E-1359108IPR001005SANT/Myb domain
SuperFamilySSF466895.24E-2860153IPR009057Homeodomain-like
PfamPF002494.2E-1560105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2461113IPR009057Homeodomain-like
CDDcd001679.79E-1263104No hitNo description
PROSITE profilePS5129424.849107161IPR017930Myb domain
SMARTSM007171.3E-14111159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-20114159IPR009057Homeodomain-like
PfamPF002491.4E-14115155IPR001005SANT/Myb domain
CDDcd001672.78E-11115157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MMTKVERFGS GMKRPFWGLS LDLTEQSAAK VVAVEEEKAD NSRSAVGRGG KGQKKKVCAR  60
GHWRPSEDDK LKELVTRFGP QNWNEIAENL AGRSGKSCRL RWFNQLDPKI TRTIFSEEEE  120
DRLITAHRMY GNKWAMIAKM FPGRTDNAVK NHWHVMMARR QREQSSPYRR RRPFSSYSSS  180
SSGSPAFPPK IGSESTATAS TCTTDLSLSP SSVRPAGCLP FSRFSPPRKY QLGANGFVVT  240
AEDDETKTKE LDNGSNNSNS CNNNGVWNRV TPGSNSSFSE NDSVETRTEN RIELIIRNDE  300
NVGIATIEFI DFLGVGSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-316016027127MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167172YRRRRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587330.11e-77PREDICTED: transcription factor LAF1-like
RefseqXP_012070362.12e-77PREDICTED: myb-related protein 330
TrEMBLA0A0B0PES88e-78A0A0B0PES8_G
STRINGPOPTR_0019s05740.13e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.13e-59myb domain protein 56